{"id":2866,"date":"2026-10-03T03:43:24","date_gmt":"2026-10-03T03:43:24","guid":{"rendered":"https:\/\/nhdbio.com\/?p=2866"},"modified":"2026-10-03T03:43:24","modified_gmt":"2026-10-03T03:43:24","slug":"secuencia-de-compra-de-especificaciones-del-peptido-ll-37","status":"publish","type":"post","link":"https:\/\/nhdbio.com\/es\/ll-37-peptide-buying-sequence-specifications\/","title":{"rendered":"Comprar LL-37: revise la secuencia, no solo el nombre"},"content":{"rendered":"

A product name is a useful search term, but a research order needs a more precise description. For LL-37, keep the sequence, terminal groups and modifications with the order. This helps avoid receiving a related fragment when your experiment requires the full peptide.<\/p>\n

37 amino acids and 12 amino acids are not the same material<\/h2>\n

A 2009 primary study lists full-length LL-37 as [LL-37, 37 aa], a 37-residue sequence. It separately lists KR-12 as KRIVQRIKDFLR, with 12 residues. These are useful identity examples: a fragment being discussed alongside LL-37 does not make it a substitute for LL-37. The study does not verify any NHD lot.<\/p>\n

Copy the ends and modifications too<\/h2>\n

A sequence written only as letters can leave terminal chemistry unclear. Ask whether the N-terminus is free or modified and whether the C-terminus is a free acid or amide. If a label, substitution or special salt form is required, write it explicitly. Keep the final agreed specification, rather than relying on an informal abbreviation.<\/p>\n

Ask what the supplied quantity means<\/h2>\n

Confirm total powder mass, vial sizes and whether peptide content has been measured. Identity testing and analytical purity should be stated separately. When your research needs an additional property, such as an endotoxin specification, ask about that test directly; a high HPLC purity number cannot answer it.<\/p>\n

A short order description<\/h2>\n

I need full-length LL-37 for the stated research project. Please confirm the exact sequence, terminal groups, modifications, salt form, quantity basis and available lot-specific documents before quotation.<\/p><\/blockquote>\n

Enlaces \u00fatiles<\/h2>\n