A product name is a useful search term, but a research order needs a more precise description. For LL-37, keep the sequence, terminal groups and modifications with the order. This helps avoid receiving a related fragment when your experiment requires the full peptide.
37 amino acids and 12 amino acids are not the same material
A 2009 primary study lists full-length LL-37 as [LL-37, 37 aa], a 37-residue sequence. It separately lists KR-12 as KRIVQRIKDFLR, with 12 residues. These are useful identity examples: a fragment being discussed alongside LL-37 does not make it a substitute for LL-37. The study does not verify any NHD lot.
Copy the ends and modifications too
A sequence written only as letters can leave terminal chemistry unclear. Ask whether the N-terminus is free or modified and whether the C-terminus is a free acid or amide. If a label, substitution or special salt form is required, write it explicitly. Keep the final agreed specification, rather than relying on an informal abbreviation.
Ask what the supplied quantity means
Confirm total powder mass, vial sizes and whether peptide content has been measured. Identity testing and analytical purity should be stated separately. When your research needs an additional property, such as an endotoxin specification, ask about that test directly; a high HPLC purity number cannot answer it.
A short order description
I need full-length LL-37 for the stated research project. Please confirm the exact sequence, terminal groups, modifications, salt form, quantity basis and available lot-specific documents before quotation.
Useful links
- LL-37 product information
- Peptide identity and quality documents
- Request LL-37 specification confirmation
For laboratory research, development and manufacturing only. Not for human or veterinary use.
Sources and examples
Reference records explain the topic; they do not establish NHD stock, a supplied lot’s results or clinical suitability. Examples explicitly labeled as hypothetical are calculations, not test data.
Sources & editorial method
AI-assisted drafting, source checks, translation and generated comic illustration. This is not independent peer review or supplied-lot verification.
1 linked records are listed in the references below. Read the editorial and AI-assistance policy.
How to interpret this article
Reference data and teaching examples are separated from NHD lot results; product specifications and availability require confirmation.
Research-use boundary: Catalog materials discussed on this website are for laboratory research, development and manufacturing use only, not for human or veterinary use. This content is not medical advice and does not provide administration instructions.
Primary records and authoritative sources
- Epand et al., LL-37 and defined fragments, 2009Primary study, Table 2: sequence identity examples; not clinical or supplied-lot evidence.
Continue with structured records
Move from this editorial analysis to the product identity, filtered evidence and controlled terminology behind it.
